PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G059300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 225aa    MW: 23319.8 Da    PI: 5.7543
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G059300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.71.5e-5722117297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +eqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy+eplk+yl+k+re
  Brast06G059300.1.p  22 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYMEPLKLYLHKFRE 112
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         legek
  Brast06G059300.1.p 113 LEGEK 117
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-5320124IPR009072Histone-fold
SuperFamilySSF471133.57E-4024124IPR009072Histone-fold
PfamPF008087.3E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-205573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.7E-207492No hitNo description
PRINTSPR006151.7E-2093111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MPESDNEDSG GGGGGGGGGG NKEQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEDYM EPLKLYLHKF RELEGEKAAV  120
VVSPGSGAGP ASQQRETPRV VSSSSNGDGG YGGMYGGGAA GGGGMFMMMG QPMYGSPPGY  180
QQQQQQHHQM MMGGKGGAYG SGYGDAGNGG GSSSSSGFGR QDRM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4822112292Transcription factor HapC (Eurofung)
4g92_B2e-4822112292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027891e-136GU902789.1 Triticum monococcum nuclear transcription factor Y subunit B5 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147727.12e-82nuclear transcription factor Y subunit B-3
SwissprotO233104e-69NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLB6SUG82e-82B6SUG8_MAIZE; Nuclear transcription factor Y subunit B-3
STRINGBRADI1G21900.12e-79(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-65nuclear factor Y, subunit B3